| Accession ID | Q85QD4 | | GenBank GI | 29497739 | | Gene Name | nad5 | | Protein Name | NADH dehydrogenase subunit 5 | | GenBank Desc | Q85QD4_PINST NADH dehydrogenase subunit 5 (Fragment) OS=Pinus strobus GN=nad5 PE=4 SV=1 | | Database | TrEMBL | | Species | Pinus strobus | | Sequence Length | 80 | | Sequence | VFDSPTVVMPIVVTFVSSLVHPHSISYMSEDPHSPRFMCHSSILTFFTPM
SVTGDNFIQLFPGWEGVGLAPYSSINSGPH |
| TG Pub ID | 1801 | | Article title | Cross-species amplification of mitochondrial DNA sequence-tagged-site markers in conifers: The nature of polymorphism and variation within and among species in Picea | | Authors | Jaramillo-correa, Juan P.; Bousquet, Jean; Beaulieu, Jean; Isabel, Nathalie; Perron, Martin; Bouille, Marie | | Article year | 2003 | |