Home Site Map Site Stats Contact Us

Icon 05 TreeGenes

Sequence Resources

Summary by Genus

Colleague Directory

Colleagues Organizations

Species Database

Forest Trees

Literature Database

Search Literature

Transcriptome Database

Search Transcriptome Transcriptome Summary

Protein Database

Search Proteins Protein Summary

Expression Studies

Search Expression Expr. Studies Summary

DiversiTree

Genotype, Phenotype & Sequence CartograTree

Comparative Mapping Database

Published Maps Maps Recently Submitted Search Cmap

Genome Transcriptome Browser

Browser Portal

Submissions

Submit to TreeGenes

Icon 02 Links

Conifer Genome Network PineRefSeq Project SMarTForests Project Conifer Translational Genomics Network TreeGenes Database Dendrome Plone Forestry Careers and Education Resource

Protein Database

Protein Detail View
Accession IDQ9MP66
GenBank GI7707332
Gene Namenad5
Protein NameNADH dehydrogenase subunit 5
GenBank DescQ9MP66_9CONI NADH dehydrogenase subunit 5 (Fragment) OS=Picea smithiana GN=nad5 PE=4 SV=1
DatabaseTrEMBL
SpeciesPicea smithiana
Sequence Length92
Sequence
FDSPTVVMPIVVTFVSSLVHPHPISYMSEDPHSPRFMCHSSIPTFFTPMS
VTGDNFIQLFPGWEGVGLAPYSSINFRSTRLQADKAAIKAML

TG Pub ID6486
Article titlePhylogeny and divergence times in Pinaceae: Evidence from three genomes
AuthorsWang, Xiao-quan; Tank, David C.; Sang, Tao
Article year2000

< new search
^ top