Welcome to the TreeGenes Project!
Protein Database
| Protein Detail View |
|
| Accession ID | | | GenBank GI | 327133585 | | Gene Name | | | Protein Name | ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit | | GenBank Desc | | | Database | NCBI | | Species | Eucalyptus kitsoniana/kitsoniana Maiden | | Sequence Length | 53 | | Sequence | mspqtetkasvgfkagvkdykltyytpdyetkdtdilaafrvtpqpgvpp
rkq |
| TG Pub ID | 5765 | | Article title | Molecular evidence shows that the tropical boxes (Eucalyptus subgenus Minutifructus) are over-ranked | | Authors | Whittock, Simon P.; Steane, Dorothy A.; Vaillancourt, Rene E.; Potts, Bradley M. | | Article year | 2003 | |
< new search
^ top