Home Site Map Site Stats Contact Us

Icon 05 TreeGenes

Sequence Resources

Summary by Genus

Colleague Directory

Colleagues Organizations

Species Database

Forest Trees

Literature Database

Search Literature

Transcriptome Database

Search Transcriptome Transcriptome Summary

Protein Database

Search Proteins Protein Summary

Expression Studies

Search Expression Expr. Studies Summary

DiversiTree

Genotype, Phenotype & Sequence CartograTree

Comparative Mapping Database

Published Maps Maps Recently Submitted Search Cmap

Genome Transcriptome Browser

Browser Portal

Submissions

Submit to TreeGenes

Icon 02 Links

Conifer Genome Network PineRefSeq Project SMarTForests Project Conifer Translational Genomics Network TreeGenes Database Dendrome Plone Forestry Careers and Education Resource

Protein Database

Protein Detail View
Accession IDQ2EHP5
GenBank GI87247472
Gene Name
Protein NamePutative 40S ribosomal protein S7
GenBank DescQ2EHP5_POPCA Putative 40S ribosomal protein S7 (Fragment) OS=Populus canadensis PE=2 SV=1
DatabaseTrEMBL
SpeciesPopulus x canadensis
Sequence Length164
Sequence
MFTTRKKIQKDKDAEPTEFEETVAQALFDLENSNSDLKSELKDLFINSAV
QIDVAGNRKAIVIYVPYRLRKSYRKVHLRLVRELEKKFSGKDVVLLATRR
IVRPPKKGSAVQRPRSRTLTAVHEAMLEDLVYPAEIVGKRTRYRIDGSKI
SKIFLDPKERNNTE

TG Pub ID10800
Article titleIdentification of differentially expressed genes induced by ozone stress in sensitive and tolerant poplar hybrids
AuthorsRizzo, Milena; Bernardi, Rodolfo; Salvini, Mariangela; Nali, Cristina; Lorenzini, Giacomo; Durante, Mauro
Article year2007

< new search
^ top