Home Site Map Site Stats Contact Us

Icon 05 TreeGenes

Sequence Resources

Summary by Genus

Colleague Directory

Colleagues Organizations

Species Database

Forest Trees

Literature Database

Search Literature

Transcriptome Database

Search Transcriptome Transcriptome Summary

Protein Database

Search Proteins Protein Summary

Expression Studies

Search Expression Expr. Studies Summary

Association PopGen

View TGDR

DiversiTree

Genotype, Phenotype & Sequence CartograTree

Comparative Mapping Database

Published Maps Maps Recently Submitted Search Cmap

Genome Transcriptome Browser

Browser Portal

Submissions

Submit to TreeGenes

Icon 02 Links

Conifer Genome Network PineRefSeq Project SMarTForests Project Conifer Translational Genomics Network TreeGenes Database Dendrome Plone Forestry Careers and Education Resource

Protein Database

Protein Detail View
Accession IDA5JYE6
GenBank GI147744703
Gene Name
Protein NameR2R3-MYB transcription factor MYB2
GenBank DescA5JYE6_PICGL R2R3-MYB transcription factor MYB2 OS=Picea glauca PE=2 SV=1
DatabaseTrEMBL
SpeciesPicea glauca
Sequence Length448
Sequence
MGRHLCCNQQKVKRGLWSPDEDEKLINYITKYGYGCWSEVPEKSGLQRCG
KSCRLRWINYLRPDIRRGNFSPNEEKLIIHLHTMVGNRWAYIASHLPGRT
DNEIKNYWNSWIKKKLAKAEIISKNIEASKVHNNLPQFLFEQSATRDNDC
KLLKTEMTTDGHAAPLSHVLPSKENSETFPLWDYKMINPSTTRNSLYGIE
ESKAALTFDSLLIRTDSETGAIKELNTWDPSGILINSSSKNCKNSDLQYA
LQRDNGLQVQGLPASSTWHGYSSLNPIESSFCYNPNSENSNGLHSTSSMN
ESDFMRSMDMAPLIYSQHETLDLADHANVATMWASGSSSNGVDLGYSECL
YSAEQYNHGTENSCSYLPPLYDASEESAAINIKHNENNSLRYLEQIQSNE
INIAQEMDAIQQIFECGEQNSNLVTTIQYCLGSHSPVSDSHHPQDTFD

TG Pub ID1653
Article titleConifer R2R3-MYB transcription factors: sequence analyses and gene expression in wood-forming tissues of white spruce (Picea glauca)
AuthorsBedon, Frank; Grima-pettenati, Jacqueline; Mackay, John
Article year2007

< new search
^ top