Home Site Map Site Stats Contact Us

Icon 05 TreeGenes

Sequence Resources

Summary by Genus

Colleague Directory

Colleagues Organizations

Species Database

Forest Trees

Literature Database

Search Literature

Transcriptome Database

Search Transcriptome Transcriptome Summary

Protein Database

Search Proteins Protein Summary

Expression Studies

Search Expression Expr. Studies Summary

DiversiTree

Genotype, Phenotype & Sequence CartograTree

Comparative Mapping Database

Published Maps Maps Recently Submitted Search Cmap

Genome Transcriptome Browser

Browser Portal

Submissions

Submit to TreeGenes

Icon 02 Links

Conifer Genome Network PineRefSeq Project SMarTForests Project Conifer Translational Genomics Network TreeGenes Database Dendrome Plone Forestry Careers and Education Resource

Protein Database

Protein Detail View
Accession IDQ9TJ00
GenBank GI6520789
Gene Namerps18
Protein Name30S ribosomal protein S18
GenBank DescQ9TJ00_ABIMR 30S ribosomal protein S18 (Fragment) OS=Abies mariesii GN=rps18 PE=4 SV=1
DatabaseTrEMBL
SpeciesAbies mariesii
Sequence Length53
Sequence
RINAAARANGVSYNRFIQYLYKRQLLPNRKTLAQIAVLDSNCFSTILKKE
LIV

TG Pub ID5779
Article titleMolecular phylogenetic position of Japanese Abies (Pinaceae) based on chloroplast DNA sequences
AuthorsSuyama, Yoshihisa; Yoshimaru, Hiroshi; Tsumura, Yoshihiko
Article year2000

< new search
^ top